Transcript | Ll_transcript_442649 |
---|---|
CDS coordinates | 362-883 (+) |
Peptide sequence | MNMGRGRKNLKRASEEEHVTLQDGQTIMQVLSLRGSNLIEVMDAHGEKSLALFPAKFQKSMWMKRGSFVVVDESAKEKALESGCKVACIVSQVLFFEQVRELKKSPEWPEIFKSGIGDSNERTTSQQEKKMVKSDDDDSDSDGLPPLEANTNRIRPVELQADDDSESGSDTDT* |
ORF Type | complete |
Blastp | Probable RNA-binding protein EIF1AD from Bos with 36.72% of identity |
---|---|
Blastx | Probable RNA-binding protein EIF1AD from Bos with 36.72% of identity |
Eggnog | eukaryotic translation initiation factor 1A domain containing(ENOG4111N6Z) |
Kegg | Link to kegg annotations (615726) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414213.1) |
Pfam | Translation initiation factor 1A / IF-1 (PF01176.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer