Protein coding transcript 466

• Transcript: Ll_transcript_496272
• CDS coordinates: 2-325 (+)
• Peptide sequence: SYLVWKHGDGFNGIAKGPLILYSTQLALNWAWSPIFFGAHDLKWSLVEITVLDINVALCAFAFYNVHKPAGLLLLPYLAWLGVATALNYVIYRDNKSVTDKGETKSK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_496272

• Blastp: Translocator protein from Rattus with 50% of identity
• Blastx: Translocator protein from Homo with 52.63% of identity
• Eggnog: tspo and mbr like protein(COG3476)
• Kegg: Link to kegg annotations (24230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014495651.1)
• Pfam: TspO/MBR family (PF03073.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;