Transcript | Ll_transcript_441808 |
---|---|
CDS coordinates | 114-989 (+) |
Peptide sequence | MILLQSQSRFLLHTLLNRIQNLEKSVELDHHWVEFDDVRYHVQVSIKNPHILLLSVSLPTPSSETIFIRGLPFGAIEAIKAAYGGLVQILDPPRDAFNLTLKINLSKLPSNQEQKHAFLVKVASIREVVLGAPLRVILKHLASRTVAPNVDPLVALVHRPKESFFVAPQADKVTVVYPMRFSDSIDIVLATSFLQEFVEARRTAGLNNTPLCSWSHTPPLELKGVSSDALSANAGFVTFVIFPRHVEGQKLDRTVWSLSTFHAYVSYHVKCSEGFMHTRMRRRVESLIQVI* |
ORF Type | complete |
Blastp | Actin-related protein 2/3 complex subunit 2A from Arabidopsis with 71.48% of identity |
---|---|
Blastx | Actin-related protein 2/3 complex subunit 2A from Arabidopsis with 71.48% of identity |
Eggnog | protein 2 3 complex subunit(ENOG410YKF6) |
Kegg | Link to kegg annotations (AT1G30825) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424524.1) |
Pfam | Arp2/3 complex, 34 kD subunit p34-Arc (PF04045.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer