Transcript | Ll_transcript_442073 |
---|---|
CDS coordinates | 556-1005 (+) |
Peptide sequence | MASIQRASVSSGSEGGEPAKVDDRKRKRMISNRESARRSRMRKQKLLEDLTEEVNRLQSSNKEIVQSIKTKEDAYSKMESANNILRAQTTELADRLQSLNSIINRAEEVNGKGNGFFYQISQISDPLMNPWQQNYPFYPLMPSPNMFLH* |
ORF Type | complete |
Blastp | bZIP transcription factor 53 from Arabidopsis with 50.39% of identity |
---|---|
Blastx | bZIP transcription factor 53 from Arabidopsis with 50% of identity |
Eggnog | Ocs element-binding factor(ENOG410YP2C) |
Kegg | Link to kegg annotations (AT3G62420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426792.1) |
Pfam | Basic region leucine zipper (PF07716.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer