Protein coding transcript 46661

• Transcript: Ll_transcript_442074
• CDS coordinates: 544-999 (+)
• Peptide sequence: MASIQRSAASSGSEGGDPALIDDRKRKRMLSNRESARRSRMRKQKVLQDLTEEVYQLQTSNMEITQSIKTKEDSYLKMESANNILRAQTMELSDRLHSLNSIIEMAEKVNGNGSFNVFPIEMPQISDPFMNPWPLYYPFHPLMASPDMSLH*
• ORF Type: complete

Annotations of Ll_transcript_442074

• Blastp: bZIP transcription factor 53 from Arabidopsis with 47.02% of identity
• Blastx: bZIP transcription factor 53 from Arabidopsis with 46.2% of identity
• Eggnog: Ocs element-binding factor(ENOG410YP2C)
• Kegg: Link to kegg annotations (AT3G62420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452343.1)
• Pfam: Basic region leucine zipper (PF07716.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;