Transcript | Ll_transcript_496300 |
---|---|
CDS coordinates | 2-397 (+) |
Peptide sequence | PNIILGDVDLTEAVETAHFGLFFNMGQCCCAGSRTFVQEDIYDKFVEAAAERANKRSVGNPFDLNVEQGPQIDGEQMDKILDLIKSGEKDGAKLVAGGKRVGDKGFFVAPTVFADVKDDMRIAKEEIFGPVQ |
ORF Type | internal |
Blastp | Aldehyde dehydrogenase X, mitochondrial from Rattus with 62.88% of identity |
---|---|
Blastx | Aldehyde dehydrogenase X, mitochondrial from Rattus with 62.88% of identity |
Eggnog | Dehydrogenase(COG1012) |
Kegg | Link to kegg annotations (298079) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020217837.1) |
Pfam | Aldehyde dehydrogenase family (PF00171.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer