Protein coding transcript 4671

• Transcript: Ll_transcript_503614
• CDS coordinates: 706-1011 (+)
• Peptide sequence: MGIKKYLVFNVGESPQGTETSWVMQEYHICSFGFDTSCYQSADKRRQIHDQSWSNWVLCRVYENKSQNFNCHDDDSGSELSLLDEVYMCLDEDLEEISMPK*
• ORF Type: complete

Annotations of Ll_transcript_503614

• Blastp: NAC domain-containing protein 104 from Arabidopsis with 45.1% of identity
• Blastx: NAC domain-containing protein 104 from Arabidopsis with 42.47% of identity
• Eggnog: (NAC) domain-containing protein(ENOG410YHMV)
• Kegg: Link to kegg annotations (AT5G64530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416550.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;