| Transcript | Ll_transcript_442391 |
|---|---|
| CDS coordinates | 307-639 (+) |
| Peptide sequence | MRLLTGETVNDFRFVPQSLVSFGNTVIVEGCDGNRKICWVHAWTVSDGIITQVREYFNTSLTVTRLGDSDSDSDSGSEIVGSDSVPFACVWESSVSNRVGKSVPGLVLAI* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Senescence associated gene 20 from Arabidopsis with 56.52% of identity |
| Eggnog | wound-induced protein(ENOG41125QD) |
| Kegg | Link to kegg annotations (AT3G10985) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415250.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer