Protein coding transcript 46731

• Transcript: Ll_transcript_442393
• CDS coordinates: 9-680 (+)
• Peptide sequence: MNKLQLKPTAPDQPCIIHSPYKTPLPSLSPNLKSSCSISKITFSTESLNSPKDLANLSEEADSKNQKLVLTLYDALNSSDSDTVSKTLASDLEWWFHGPPSHQFLMHILTGEANSVNDFRFVPQSIVSFGNIVIVEGCDGNRDIAWVHAWTVSDGIITQVREYLNTALTVTRIGNSQFDSDSDSDSGSEIVPAISDSARFTCVWESTVSDRVGKSVPGLVLAI*
• ORF Type: complete

Annotations of Ll_transcript_442393

• Blastp: Senescence associated gene 20 from Arabidopsis with 55.46% of identity
• Blastx: Senescence associated gene 20 from Arabidopsis with 54.62% of identity
• Eggnog: wound-induced protein(ENOG41125QD)
• Kegg: Link to kegg annotations (AT3G10985)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416341.1)
• Pfam: Wound-induced protein WI12 (PF07107.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;