| Transcript | Ll_transcript_503447 |
|---|---|
| CDS coordinates | 111-827 (+) |
| Peptide sequence | MSQRIPRRRSLLIGGRRTKPPPRPSPSPRRRPLKILKRCSSAPLLFGRARDDDDFDEHFGSRRETIFHPQTFLDGFLSSPSLFPSSPYSHSKQIKTQGYNKEAKVVVNVTVEGSPGPIRTMVKLGSSVEDTIKRVVDRYNEEGRSPKLNPKPSSFFQLHDSHFSLQSLDKSEVIGDVGSRSFYLRKNGSLSALNSFHSESGPCNIAAPPLLPSSFIARKINKIVRRAQRLWNIVICSQ* |
| ORF Type | complete |
| Blastp | Uncharacterized protein At4g22758 from Arabidopsis with 48.6% of identity |
|---|---|
| Blastx | Uncharacterized protein At4g22758 from Arabidopsis with 51.66% of identity |
| Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
| Kegg | Link to kegg annotations (AT4G22758) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019445082.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer