Protein coding transcript 46772

• Transcript: Ll_transcript_443256
• CDS coordinates: 37-978 (+)
• Peptide sequence: MAQRSLLLLLFCAVVVAAASGSSFNDFNPIRLVSEGLRDVEAQVLDIIGQSRHAVSFARFVHSYEKRYESSDEMKQRFQIFSDNLKRIRSINKKRLSYTLGVNRFSDWTWEEFKTHRLGAAQNCSATLKGNHKITDAILPEHKDWRKEGIVSPVKDQGQCGSCWTFSTTGALEAAYAQAFGRNISLSEQQLVDCAGAFSNFGCDGGLPSQAFEYIKYNGGLDTEKAYPYTASNGLCKFSAENVGVRVLDSVNITLGAEDELKHAVAFVRPVSVAFQVVDDFQSYKKGVYTSHICGNTPLVSIPTLFSKHNYNY*
• ORF Type: complete

Annotations of Ll_transcript_443256

• Blastp: Thiol protease aleurain-like from Arabidopsis with 68.81% of identity
• Blastx: Thiol protease aleurain from Arabidopsis with 72.83% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (AT3G45310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455184.1)
• Pfam: Cathepsin propeptide inhibitor domain (I29) (PF08246.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;