Protein coding transcript 46787

• Transcript: Ll_transcript_443268
• CDS coordinates: 68-1159 (+)
• Peptide sequence: MSSSPSFSSSESESETPHNLIPSLPDDVAINCLSRVPRSHHPTLSLLSKPIHSLLSSPLFFSSRSSPEHLLYLTLRPRASPLQHFTLHLNPFTNRRYLVPLPPTPSPSVGSAYAVLGPTIYVIGGSRNDIPFNHVWLLDCRFHRWIPGPSMRVGREFPAAGVVDGKIYVIGGCVADTWSRSAAWAEVFDPAVNRWERVASPVEFREKWMHASAVIGGKFYAMADRGGMVFDPRSGVWESVGREMDNGWRGRACVVDEVLYCYDYLGKIKGFDVRSGVWKEVKGLGKGLLPRFLCGATMANVGGKLVVVWECDGNGKEMEVWCAEIEVKMDGTNGELLGEVGWIEKVLCVPKGSSIVQCCSVTL*
• ORF Type: complete

Annotations of Ll_transcript_443268

• Blastp: F-box/kelch-repeat protein SKIP6 from Arabidopsis with 53.33% of identity
• Blastx: F-box/kelch-repeat protein SKIP6 from Arabidopsis with 51.11% of identity
• Eggnog: Kelch repeat-containing F-box family protein(ENOG4110X8D)
• Kegg: Link to kegg annotations (AT2G21950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430235.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;