Transcript | Ll_transcript_442847 |
---|---|
CDS coordinates | 192-770 (+) |
Peptide sequence | MFSLLQVPRCRIHCLANYWGETFHSFNKTYGDNSSTIRLLSSKTYGLQGGQRKKWTRRPITTNTEGTGRTKSRSTKNEILSETILTSATVNVHKAPIDQSQAIQDCVIQQEIAQNKDLSSLVTVIVFDIETTGFSREKDRIIEIALRDLQGGENSTFQTLVNPQRDILNSEIHSITTQMVDRPDVPRLPKSL* |
ORF Type | complete |
Blastp | Exonuclease DPD1, chloroplastic/mitochondrial from Arabidopsis with 41.8% of identity |
---|---|
Blastx | Exonuclease DPD1, chloroplastic/mitochondrial from Arabidopsis with 42.33% of identity |
Eggnog | three prime repair exonuclease(ENOG4111YSP) |
Kegg | Link to kegg annotations (AT5G26940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419638.1) |
Pfam | Exonuclease (PF00929.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer