Protein coding transcript 46803

• Transcript: Ll_transcript_442020
• CDS coordinates: 296-658 (+)
• Peptide sequence: MADSPTSSKSNSLIHRPTTATRGGWHAAIFIIFVEFAERFAYQGMASNLVIYLTHVMNVPDTEAVKDVNTWVGVSALFPLIGAFIADSYLGRFKTILISSIIYLLVIISFLSYFISSHFF*
• ORF Type: complete

Annotations of Ll_transcript_442020

• Blastp: Protein NRT1/ PTR FAMILY 5.4 from Arabidopsis with 55.45% of identity
• Blastx: Protein NRT1/ PTR FAMILY 5.4 from Arabidopsis with 55.68% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT3G54450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453493.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;