Transcript | Ll_transcript_442020 |
---|---|
CDS coordinates | 296-658 (+) |
Peptide sequence | MADSPTSSKSNSLIHRPTTATRGGWHAAIFIIFVEFAERFAYQGMASNLVIYLTHVMNVPDTEAVKDVNTWVGVSALFPLIGAFIADSYLGRFKTILISSIIYLLVIISFLSYFISSHFF* |
ORF Type | complete |
Blastp | Protein NRT1/ PTR FAMILY 5.4 from Arabidopsis with 55.45% of identity |
---|---|
Blastx | Protein NRT1/ PTR FAMILY 5.4 from Arabidopsis with 55.68% of identity |
Eggnog | transporter(COG3104) |
Kegg | Link to kegg annotations (AT3G54450) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453493.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer