Protein coding transcript 46807

• Transcript: Ll_transcript_442025
• CDS coordinates: 148-546 (+)
• Peptide sequence: MADSPTRRGGWHAAIFIIFVEFGERFAYQGIASNLVIYLIHVLHVPDTIAVKIVNTWVGVSALFPLLGAFIADSYLGRFKTILFSSLIYLLVILSFYISILSLLLLLLLLLFNGFLLCFSFLLDSHVLSTFV*
• ORF Type: complete

Annotations of Ll_transcript_442025

• Blastp: Protein NRT1/ PTR FAMILY 5.4 from Arabidopsis with 53.33% of identity
• Blastx: Protein NRT1/ PTR FAMILY 5.4 from Arabidopsis with 55.81% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT3G54450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449380.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;