Transcript | Ll_transcript_442027 |
---|---|
CDS coordinates | 1-495 (+) |
Peptide sequence | LIPYLQQKGWWALGFGLMVVVMAIAMALFLLGIKRYKKEGPSGSPFTRLAQVFVAAARKWRVSYTSDSNKYCNEEPHNTIAHKLLHTDEYRLLDKAMIIDEVDARSKRRDPWRLCSVTQVEELKLVLRLIPIWLSCLMFNVVQAQTHTYFVKQGNLTFISLPYT* |
ORF Type | 5prime_partial |
Blastp | Protein NRT1/ PTR FAMILY 5.4 from Arabidopsis with 47.2% of identity |
---|---|
Blastx | Protein NRT1/ PTR FAMILY 5.4 from Arabidopsis with 47.2% of identity |
Eggnog | transporter(COG3104) |
Kegg | Link to kegg annotations (AT3G54450) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019412756.1) |
Pfam | POT family (PF00854.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer