Protein coding transcript 46814

• Transcript: Ll_transcript_441820
• CDS coordinates: 325-885 (+)
• Peptide sequence: MVFPNQSMLVSDQRKINGRGKIEIKRIENITNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKASIERYKKANSDSSSAGSTSEANAQFYQQEAAKLRVQISNLQNHNRQMMGEALSPMNAKELKSLETKLEKGISRIRSKKNELLFAEIEYMQKREIDLHNNNQLLRAKV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_441820

• Blastp: Floral homeotic protein AGAMOUS from Lycopersicon with 82.58% of identity
• Blastx: Floral homeotic protein AGAMOUS from Nicotiana with 82.58% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (543840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462646.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;