Transcript | Ll_transcript_441897 |
---|---|
CDS coordinates | 472-1077 (+) |
Peptide sequence | MEIDNSNSSDARSKKMEDYEVIEQIGRGAFGSAFLVLHNSEKKRYVLKKIRLAKQTDKFKMTAHQEMNLIAKLKNPYIVEYKDAWVEKEDHICIITGYCEGGDMAEKIKRARGSLFPEEKVCKWLTQLLIALDYLHSNRVIHRDLKCSNIFLTKDKNIRLGDFGLAKRLHTEDLTSSVVGTPNYMCPELLADIPYGYKSDMW |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein kinase Nek6 from Oryza sativa with 74.33% of identity |
---|---|
Blastx | Serine/threonine-protein kinase Nek6 from Oryza sativa with 74.33% of identity |
Eggnog | NIMA-related kinase(ENOG410Y7JF) |
Kegg | Link to kegg annotations (4329828) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425897.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer