Protein coding transcript 46855

• Transcript: Ll_transcript_441911
• CDS coordinates: 2181-2504 (+)
• Peptide sequence: MKHCLFVRSRAEKIKRARGSLFPEEKVCKWLTQLLIALDYLHSNRVIHRDLKCSNIFLTKDNNIRLGDFGLAKRLHTEDLTSSVVGTPNYMCPELLADIPYGYKSDMW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_441911

• Blastp: Serine/threonine-protein kinase Nek6 from Oryza sativa with 79.59% of identity
• Blastx: Serine/threonine-protein kinase Nek6 from Oryza sativa with 79.59% of identity
• Eggnog: NIMA-related kinase(ENOG410Y7JF)
• Kegg: Link to kegg annotations (4329828)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444108.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;