Transcript | Ll_transcript_307428 |
---|---|
CDS coordinates | 46-447 (+) |
Peptide sequence | MADPEKQPEQPKAVPQKPVIANKVTGVVKWFNVKSGYGFINRNDSKEDVFVHQSAIVKNNPKKAVRSVGDGEVVEFDVVVGEKGNEAANVTGPAGEPVKGSPYAADKRRGYRQWYYGGRGGRGMRPRREGYESG |
ORF Type | 3prime_partial |
Blastp | Y-box factor homolog from Aplysia with 68% of identity |
---|---|
Blastx | Y-box factor homolog from Aplysia with 68.97% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014500223.1) |
Pfam | 'Cold-shock' DNA-binding domain (PF00313.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer