Transcript | Ll_transcript_442059 |
---|---|
CDS coordinates | 945-1586 (+) |
Peptide sequence | MLQKDFCEALLEEIENFEKWVTEAKFRIMRPNTMNKYGAVLDDFGFETMLDKLMEGFIRPLSRVFFAEVGGSTLDSHHGFVVEYGQDRDVDLGFHVDDSEVTLNVCLGKQFSGGELFFRGTRCEKHVNTGTQSEEIFDYSHAPGQAVLHRGRHRHGSRATTSGHRINLLLWCRSSVFREMKRYQKDFPSWCGECNREKKERQRSSIATRLVIL* |
ORF Type | complete |
Blastp | Uncharacterized PKHD-type hydroxylase At1g22950 from Arabidopsis with 66.67% of identity |
---|---|
Blastx | Uncharacterized PKHD-type hydroxylase At1g22950 from Arabidopsis with 57.1% of identity |
Eggnog | Procollagen-lysine 2-oxoglutarate 5-dioxygenase(ENOG410Y4QU) |
Kegg | Link to kegg annotations (AT1G22950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436708.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer