Transcript | Ll_transcript_307429 |
---|---|
CDS coordinates | 46-318 (+) |
Peptide sequence | MADPEKQPEQPKAVPQKPVIANKVTGVVKWFNVKSGYGFINRNDSKEDVFVHQSAIVKNNPKKAVRSVGDGEVVEFDVVVMEKWLSSTLW* |
ORF Type | complete |
Blastp | Y-box factor homolog from Aplysia with 66.3% of identity |
---|---|
Blastx | Y-box factor homolog from Aplysia with 63.16% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014500223.1) |
Pfam | 'Cold-shock' DNA-binding domain (PF00313.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer