Transcript | Ll_transcript_442189 |
---|---|
CDS coordinates | 2018-2395 (+) |
Peptide sequence | MHLVKLIGYYEDRCQQLLVYEYLPNGNVGNHLYDSEGLPLGRLDLWRRLSIALGAAKGLEHLHSLVPPLVHTNFRTRNVLLDENYTAKVSDYGFFKMQRKADQPGSSSNIDCFLDPEYATILHVL* |
ORF Type | complete |
Blastp | Putative serine/threonine-protein kinase-like protein CCR3 from Arabidopsis with 37.4% of identity |
---|---|
Blastx | Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 40.15% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT3G55950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447876.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer