Protein coding transcript 47185

• Transcript: Ll_transcript_442202
• CDS coordinates: 147-1322 (+)
• Peptide sequence: MDNTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADKCNVLVNIEQQSPDIAQGVHGHMTKAPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYRNDNGAMVPLRVHTVLISTQHDETVTNEQIAADLKEHVIKPVIPTQYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAIHLDLTRGGNFRYQKTAAYGHFGRDDSDFTWETVKALKPKA*
• ORF Type: complete

Annotations of Ll_transcript_442202

• Blastp: S-adenosylmethionine synthase 2 from Nicotiana with 94.07% of identity
• Blastx: S-adenosylmethionine synthase 1 from Vitis with 94.33% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107807060)
• CantataDB: Link to cantataDB annotations (CNT0001925)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425510.1)
• Pfam: S-adenosylmethionine synthetase, N-terminal domain (PF00438.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;