Transcript | Ll_transcript_442204 |
---|---|
CDS coordinates | 1257-2441 (+) |
Peptide sequence | MPEMDNTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVNYEKIVRDTCRGIGFVSADVGLDADKCNVLVNIEQQSPDIAQGVHGHMTKAPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYRNDNGAMVPLRVHTVLISTQHDETVTNEQIAADLKEHVIKPVIPTQYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAIHLDLTRGGNFRYQKTAAYGHFGRDDSDFTWETVKALKPKA* |
ORF Type | complete |
Blastp | S-adenosylmethionine synthase 2 from Nicotiana with 94.07% of identity |
---|---|
Blastx | S-adenosylmethionine synthase 1 from Vitis with 94.33% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107807060) |
CantataDB | Link to cantataDB annotations (CNT0001925) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425510.1) |
Pfam | S-adenosylmethionine synthetase, N-terminal domain (PF00438.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer