Protein coding transcript 472

• Transcript: Ll_transcript_523497
• CDS coordinates: 2-364 (+)
• Peptide sequence: PNSQSRLPPRTLTGSLFHPQLNLTNMPGVRDVSAEAFITAYSSHLKRSGKLDVPVWVDIVKTGTGKELAPYDADWYYIRSAAVARHIYLRKHVGVGALQKLHGSAANRGNRPSHHTDASDS
• ORF Type: internal

Annotations of Ll_transcript_523497

• Blastp: 40S ribosomal protein S19-A from Schizosaccharomyces with 68.82% of identity
• Blastx: 40S ribosomal protein S19-A from Schizosaccharomyces with 68.82% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC21C3.13)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413135.1)
• Pfam: Ribosomal protein S19e (PF01090.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;