Transcript | Ll_transcript_523497 |
---|---|
CDS coordinates | 2-364 (+) |
Peptide sequence | PNSQSRLPPRTLTGSLFHPQLNLTNMPGVRDVSAEAFITAYSSHLKRSGKLDVPVWVDIVKTGTGKELAPYDADWYYIRSAAVARHIYLRKHVGVGALQKLHGSAANRGNRPSHHTDASDS |
ORF Type | internal |
Blastp | 40S ribosomal protein S19-A from Schizosaccharomyces with 68.82% of identity |
---|---|
Blastx | 40S ribosomal protein S19-A from Schizosaccharomyces with 68.82% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBC21C3.13) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413135.1) |
Pfam | Ribosomal protein S19e (PF01090.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer