Protein coding transcript 47200

• Transcript: Ll_transcript_443503
• CDS coordinates: 1471-2016 (+)
• Peptide sequence: MPNRNDAGLAAAELSLAVEKHVLESGSNDTVGTVGILELHPGAINSIPSKSHIEIDTRDIDEERRNRVIEKIHQSAIKITKTRGVKLSEFSIINQDPPALSSEAVIKAVETATRELNLTSKLMISRAYHDSLFMARLSPTGMIFIPCYKGYSHKPEEFASSEDVANGVKVLASTLAKLSLQ*
• ORF Type: complete

Annotations of Ll_transcript_443503

• Blastp: Ureidoglycolate hydrolase from Arabidopsis with 76.22% of identity
• Blastx: Probable ureidoglycolate hydrolase from Oryza sativa with 79.42% of identity
• Eggnog: succinyl-diaminopimelate desuccinylase activity(COG0624)
• Kegg: Link to kegg annotations (AT5G43600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014514710.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;