Protein coding transcript 47207

• Transcript: Ll_transcript_442804
• CDS coordinates: 279-941 (+)
• Peptide sequence: MEPSESDSALVSIGSSVTDPQLGSQSAPSSIHSHHDRGPEPSDLSHVTQDEEEEALGAELETKLDLKGEGEVGGETVDKVSNFDDGEQVCDEGSGGGVIEVEESVKVNVNDGFGGNIRGWDCNSWDEDVNDGVNVNEGFNEYEVGGDDYAVNDGDWAQVEDKIRGRTQHYPLRPGAEDCAYFMKTGNCKFGFNCKFNHPIRTRNQVFMPFFLCVLLRLVS*
• ORF Type: complete

Annotations of Ll_transcript_442804

• Blastp: Zinc finger CCCH domain-containing protein 43 from Arabidopsis with 44.3% of identity
• Blastx: Zinc finger CCCH domain-containing protein 43 from Arabidopsis with 62.3% of identity
• Eggnog: zinc finger(COG5063)
• Kegg: Link to kegg annotations (AT3G48440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457493.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;