Protein coding transcript 47356

• Transcript: Ll_transcript_443171
• CDS coordinates: 1-369 (+)
• Peptide sequence: SLNFRESNNAGNRLIAALSLPRYHYVKQINLEFAPDVDDTHLILIKDKCFDSLQRLESLNLNGCRKISDTGIEAITSCCPQLKTFSIYWNVRVTDTGLIHTVRNCKHIVDLNISGCKHRPGA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_443171

• Blastp: F-box protein At3g58530 from Arabidopsis with 67.52% of identity
• Blastx: F-box protein At3g58530 from Arabidopsis with 71.67% of identity
• Eggnog: F-box protein(ENOG410Z034)
• Kegg: Link to kegg annotations (AT3G58530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426638.1)
• Pfam: Leucine rich repeats (6 copies) (PF13306.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;