Protein coding transcript 47491

• Transcript: Ll_transcript_424243
• CDS coordinates: 564-1265 (+)
• Peptide sequence: MIFGNRNSNTPFEDGLVYIEADPSGSDSWKLEPVINLLKEGAVGVIPTDTLYAIACDLRNHSAIERLRRIKNIEVSKPLSILCHSFRDIDKYTAGFPRGDGQGHANLFKVVKQCIPGPYTFILMASKELPKQCIRFGTNAAKYASRKNVGVRMPEDAICQAILKEMDAPLICTSIKFLKEDEWMIDPVMIADTYGPEGLDFVVAGGVRVAEPSTVVDMTKMPPRVLRQGKVET*
• ORF Type: complete

Annotations of Ll_transcript_424243

• Blastp: Uncharacterized protein YciO from Shigella with 27.54% of identity
• Blastx: Uncharacterized protein YciO from Shigella with 27.54% of identity
• Eggnog: sua5 ycio yrdc ywlc family protein(COG0009)
• Kegg: Link to kegg annotations (SF1270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457191.1)
• Pfam: Telomere recombination (PF01300.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;