Protein coding transcript 47492

• Transcript: Ll_transcript_424244
• CDS coordinates: 510-905 (+)
• Peptide sequence: MIFGNRNSNTPFEDGLVYIEADPSGSDSWKLEPVINLLKEGAVGVIPTDTLYAIACDLRNHSAIERLRRIKNIEVSKPLSILCHSFRDIDKYTAGFPRGDGQGHANLFKVVKQCIPGPVIHFYLNGKQRIT*
• ORF Type: complete

Annotations of Ll_transcript_424244

• Blastp: Threonylcarbamoyl-AMP synthase from Pseudomonas with 31.94% of identity
• Blastx: Uncharacterized protein YciO from Shigella with 35.09% of identity
• Eggnog: sua5 ycio yrdc ywlc family protein(COG0009)
• Kegg: Link to kegg annotations (Pfl01_0020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004514618.1)
• Pfam: Telomere recombination (PF01300.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;