Transcript | Ll_transcript_424224 |
---|---|
CDS coordinates | 3-839 (+) |
Peptide sequence | LMWAYSILTYVYSATFISSFYHCQYFQPFAKSQCSHTFKFVCSHFQFQFSLTKMQMVFADKLCRFHSFLGSPVSFRSTHVFIPKTHNFGLVSMSFKRSPKRLKYTAPRFTKEDGLVYIEADPSGSDSWKLEPVINLLKEGAVGVIPTDTLYAIACDLRNHSAIERLRRIKNIEVSKPLSILCHSFRDIDKYTAGFPRGDGQGHANLFKVVKQCIPGPYTFILMASKELPKQCIRFGTNAAKYASRKNVGVRMPEDAICQAILKEMDAPLICTSIKFLKE |
ORF Type | internal |
Blastp | Uncharacterized protein YciO from Shigella with 26.8% of identity |
---|---|
Blastx | Uncharacterized protein YciO from Shigella with 26.8% of identity |
Eggnog | sua5 ycio yrdc ywlc family protein(COG0009) |
Kegg | Link to kegg annotations (SF1270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457191.1) |
Pfam | Telomere recombination (PF01300.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer