Protein coding transcript 47575

• Transcript: Ll_transcript_423947
• CDS coordinates: 408-1187 (+)
• Peptide sequence: MLIHAFQFFRKGQPKITFKIFMQIFILALLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMTFVMAALCRMEKIDMKKVRCQAKVVGTIVTVGGAMLMTLYKGPIVDIVWAKHSHSHDKSNATTKPGPSDKEWFLGCTFLIIATLAWASLFVLQAKAIETYKNHQFSLTSLICFIGTIQAIAVTFVVEHNPSVWRIGWDMNLLAAAYAGIVTSSISYYVQGLVIKTKGPVFATAFSPLMMIIVAIMGSFILAEQIYLGG*
• ORF Type: complete

Annotations of Ll_transcript_423947

• Blastp: WAT1-related protein At5g07050 from Arabidopsis with 72.09% of identity
• Blastx: WAT1-related protein At5g07050 from Arabidopsis with 72.09% of identity
• Eggnog: Auxin-induced protein(ENOG410YD20)
• Kegg: Link to kegg annotations (AT5G07050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465001.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;