Protein coding transcript 476

• Transcript: Ll_transcript_523509
• CDS coordinates: 3-497 (+)
• Peptide sequence: PIQCQRAIDEYNRDVSFIDIYNIYAPLCNNPNLTAFPKKSSIVIDPCSGAYTHAYLNRANVQEALHANVTKLKYDWESCSDILFSKWGDSPSTIIPLLHEFLNNGLRVWIFSGDTDGRVPVTSTKYSIKKMNLSTKTAWYPWFFNGEVGGYAEVYKGDLTFATVR
• ORF Type: internal

Annotations of Ll_transcript_523509

• Blastp: Serine carboxypeptidase-like 40 from Arabidopsis with 60.61% of identity
• Blastx: Serine carboxypeptidase-like 40 from Arabidopsis with 60.61% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT3G63470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425188.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;