Protein coding transcript 47606

• Transcript: Ll_transcript_422554
• CDS coordinates: 663-1229 (+)
• Peptide sequence: MLRLNVYCSLIPSANQARPLSSYDSLIIHKRRASRFSHGISIKAKAIKDEMDGETSGSSGRSWDPGLEIEVPFEQRPVNEYSSLKDGILYSWGELGPGSFFLRLGGLWLSVFIVLGVPIAAASFNPSREPLRFALAAGTGTLFIVSLIVLRIYLGWSYVGDRLLSAVIPYEESGWYDGQMWVKPPEAL*
• ORF Type: complete

Annotations of Ll_transcript_422554

• Blastp: Uncharacterized protein ycf36 from Porphyra with 43.44% of identity
• Blastx: Uncharacterized protein ycf36 from Porphyra with 43.44% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421174.1)
• Pfam: Protein of unknown function (DUF1230) (PF06799.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;