Transcript | Ll_transcript_422555 |
---|---|
CDS coordinates | 663-1442 (+) |
Peptide sequence | MLRLNVYCSLIPSANQARPLSSYDSLIIHKRRASRFSHGISIKAKAIKDEMDGETSGSSGRSWDPGLEIEVPFEQRPVNEYSSLKDGILYSWGELGPGSFFLRLGGLWLSVFIVLGVPIAAASFNPSREPLRFALAAGTGTLFIVSLIVLRIYLGWSYVGDRLLSAVIPYEESGWYDGQMWVKPPEILARDRLLGSYKVKPVVKLLKQTLVGTGALLVTGVMLFIFATPVENFFRTTFTTVENKSTTQTPKVNTKFNLR* |
ORF Type | complete |
Blastp | Uncharacterized protein ycf36 from Porphyra with 40.62% of identity |
---|---|
Blastx | Uncharacterized protein ycf36 from Porphyra with 40.62% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421174.1) |
Pfam | Protein of unknown function (DUF1230) (PF06799.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer