Protein coding transcript 47681

• Transcript: Ll_transcript_422294
• CDS coordinates: 1-579 (+)
• Peptide sequence: VAYRFIRWHQKLSNRHNLSLYSFISILTNHNFYFNFKQTLTTQKAHASPPGYFARLEDSNRSKDNFNMNKKTRMRRWLCCTFQVEETYPSNENEHLKSPGNYGDGNYKGSKASAPMKLETQKAPPPIEVPALSLDELKEKTDNFGSKALIGEGSYGRAYYATLNDGNAVAVKKLDISSEPESNNESLTQVSMV
• ORF Type: internal

Annotations of Ll_transcript_422294

• Blastp: PTI1-like tyrosine-protein kinase 3 from Arabidopsis with 63.19% of identity
• Blastx: PTI1-like tyrosine-protein kinase 3 from Arabidopsis with 63.19% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G59350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427656.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;