Transcript | Ll_transcript_422300 |
---|---|
CDS coordinates | 217-702 (+) |
Peptide sequence | MDARNFHHRPSHLAHASPPGYFARLEDSNRSKDNFNMNKKTRMRRWLCCTFQVEETYPSNENEHLKSPGNYGDGNYKGSKASAPMKLETQKAPPPIEVPALSLDELKEKTDNFGSKALIGEGSYGRAYYATLNDGNAVAVKKLDISSEPESNNESLTQVSMV |
ORF Type | 3prime_partial |
Blastp | PTI1-like tyrosine-protein kinase 3 from Arabidopsis with 60.26% of identity |
---|---|
Blastx | PTI1-like tyrosine-protein kinase 3 from Arabidopsis with 60.26% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT3G59350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427656.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer