Transcript | Ll_transcript_423329 |
---|---|
CDS coordinates | 197-1333 (+) |
Peptide sequence | MRVLQLGLLLALASGFAAISIYIIGLSNSSVYLNSQLTDEDTQALLSLHDSFEKCMSANGLGLKAIRGNDYCQTTISFPSDTTPKWRDPKTGELEVLSYDFNLCEAVATWEQVRNSTTILTKEFIDSLPNGWEEYAWRRINKGILLNRCENKTLCMEKLSLVLPETPPYFPRQFGRCAVIGNSGDLLKTKFGKEIDGYDVVIRENGAPTQNYIDHVGRKSTFRLLNRGSAKALDKVVELDEQRKEVLIVKTTIHDIMSKMIRELPIKNPVYLMLGASFGSAAKGTGLKALEFALSMCNSVDMYGFTVDPGYKEWTRYFSESRQGHTPLHGRAYYQMMECLGLIRIHSPMRSDPNRVLKWVPSRHIIRAARIASEKLLR* |
ORF Type | complete |
Blastp | Sialyltransferase-like protein 2 from Arabidopsis with 81.1% of identity |
---|---|
Blastx | Sialyltransferase-like protein 2 from Arabidopsis with 81.67% of identity |
Eggnog | ST3 beta-galactoside alpha-2,3-sialyltransferase(ENOG410XT8P) |
Kegg | Link to kegg annotations (AT3G48820) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463212.1) |
Pfam | Glycosyltransferase family 29 (sialyltransferase) (PF00777.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer