Protein coding transcript 47784

• Transcript: Ll_transcript_423487
• CDS coordinates: 80-517 (+)
• Peptide sequence: MLRQQLQDLQESHRQMMGEELSGLTVKELQTLENQLEISLRGVRVQKDQLLMDEIQDLNQKGKLIHQENMELYRKANLIHQENTELQKKVYGTRDWNGTKRNSVLTNGIRIEANLHVPVSLQLSQPQQQNYEEPTEATKLGLQLH*
• ORF Type: complete

Annotations of Ll_transcript_423487

• Blastp: MADS-box transcription factor 27 from Oryza sativa with 57.64% of identity
• Blastx: MADS-box transcription factor 27 from Oryza sativa with 59.21% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (4329771)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415009.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;