Protein coding transcript 47791

• Transcript: Ll_transcript_423503
• CDS coordinates: 539-940 (+)
• Peptide sequence: METGGIEGGGVLRFMSKLILCAISAALTGFFAIAGALGGALVGALAAKASKSSFLRGTSLGAIAGAIISVEVLEASRDFLSMDRTGSQGASYMVCSHFARDFPSSLMSKITCKSLKLLSIRGVMLSLVASLES*
• ORF Type: complete

Annotations of Ll_transcript_423503

• Blastp: NEP1-interacting protein 2 from Arabidopsis with 51.56% of identity
• Blastx: NEP1-interacting protein-like 2 from Arabidopsis with 47.58% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT2G17730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451495.1)
• Pfam: Glycine-zipper domain (PF13436.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;