Protein coding transcript 47839

• Transcript: Ll_transcript_423684
• CDS coordinates: 1-984 (+)
• Peptide sequence: QGFLDYTSQRGSSHHNDTALFYDQIKSKLQLDFNKNQLVEKIRRLKKKYRNVLNKISSGKEFLFKSAHDQATFEISRKIWSNIGQISGGVVDDNPLDEDEINLHPIPNPNNHNPNINLNLVQPGPKYEVVMLGNSGEKKSMPSKKRSRPRSGMTRIDEKPREFLNDGSGSGLNLNLNHDHKCISNSTTARVAANVNNNKNYENNCNSGKQHSSSSSIPGLIEETVKSCLTPVLKELLTAGGGGGGVMGGGTFGARGFGIGGFGSMNSIPIPMPMMPLSYLGLGSGDVVDEKWRKQQILELEVYAKRLELVQDQVKAALEELRSAGGG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_423684

• Blastp: Probable transcription factor At5g28040 from Arabidopsis with 46.67% of identity
• Blastx: Probable transcription factor At3g04930 from Arabidopsis with 71.57% of identity
• Eggnog: Transcription regulator(ENOG410YGHJ)
• Kegg: Link to kegg annotations (AT5G28040)
• CantataDB: Link to cantataDB annotations (CNT0002442)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423310.1)
• Pfam: Protein of unknown function, DUF573 (PF04504.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;