Protein coding transcript 47845

• Transcript: Ll_transcript_423690
• CDS coordinates: 1283-1696 (+)
• Peptide sequence: MPQGGIEDGEEPKSAAIRELQEETGIISAEIIAEVHNWLTYDFPPAVKAKVSRLWGGEWHGQAQKWFLMRLTKDDSEVNLANGEVDPEFAEWKWANPEEVIEQAVDYKRPTYEEVIRTFKPYFQGNDISAKCKSTKW*
• ORF Type: complete

Annotations of Ll_transcript_423690

• Blastp: Nudix hydrolase 25 from Arabidopsis with 75.54% of identity
• Blastx: Nudix hydrolase 25 from Arabidopsis with 77.12% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT1G30110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459308.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;