Protein coding transcript 47917

• Transcript: Ll_transcript_422470
• CDS coordinates: 178-972 (+)
• Peptide sequence: MEVSVPSPNKSFVEKVFGGYQYGSSSQKKNNGNEANKSHDEDSDGGMELMEIGAERTKNVLILMSDTGGGHRASAEAIRDAFQIEFGDEYRVFVKDVWKEYTGWPLNDMEGQYKFMVKHVQLWNVAFHSTSPRWIHSVYLAAIAAYYAREVEAGLMEYKPDIIISVHPLMQHIPLWVLKWQGLQKKVIFVTVITDLSTCHPTWFHPWVNRLYCPSEAVAKKASQEGGLEETQIRVYGLPIRPSFARAVLVKVYAYRRLENLQQL*
• ORF Type: complete

Annotations of Ll_transcript_422470

• Blastp: Monogalactosyldiacylglycerol synthase 2, chloroplastic from Arabidopsis with 80.44% of identity
• Blastx: Monogalactosyldiacylglycerol synthase 2, chloroplastic from Arabidopsis with 80.44% of identity
• Eggnog: Cell wall formation. Catalyzes the transfer of a GlcNAc subunit on undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide (lipid intermediate I) to form undecaprenyl-pyrophosphoryl-MurNAc- (pentapeptide)GlcNAc (lipid intermediate II) (By similarity)(COG0707)
• Kegg: Link to kegg annotations (AT5G20410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440827.1)
• Pfam: Monogalactosyldiacylglycerol (MGDG) synthase (PF06925.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;