Protein coding transcript 47970

• Transcript: Ll_transcript_423439
• CDS coordinates: 235-828 (+)
• Peptide sequence: MTTEEVAAVKEVAAVPAAAPEPETGSKNKLERRWTFWLDNQSKPKQGAAWGSSLRTVYTFDTVQEFWSLYEHIFKPSKLTGNADFHLFKTGIEPKWEDPECANGGKWTVSSNRKANLETMWLETLMALIGEQFDDAEDICGVVASVRQRQDKISLWTKTAANEAAQGMHAKALEIKEGECIFKMVGVSIHKMSIGRKW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_423439

• Blastp: Eukaryotic translation initiation factor isoform 4E-2 from Zea with 71.24% of identity
• Blastx: Eukaryotic translation initiation factor isoform 4E-2 from Triticum with 76.98% of identity
• Eggnog: eukaryotic translation initiation factor(COG5053)
• Kegg: Link to kegg annotations (541708)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449972.1)
• Pfam: Eukaryotic initiation factor 4E (PF01652.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;