Protein coding transcript 48109

• Transcript: Ll_transcript_421895
• CDS coordinates: 322-750 (+)
• Peptide sequence: MASLDMSLDDRIKNRSSRGRGRGRGRAGSGRGASRTFNGGRVSGAANGGRVSAAANGGRVSGAARRGPLVLNARPSSYAIAKSIRGTRPFPWQRTDLFEDSLRAAGISGIDVGTKLYISNLDHGVTNGDIRVHIMPYLHMLP*
• ORF Type: complete

Annotations of Ll_transcript_421895

• Blastp: THO complex subunit 4D from Arabidopsis with 61.9% of identity
• Blastx: THO complex subunit 4D from Arabidopsis with 67.78% of identity
• Eggnog: Polymerase (DNA-directed), delta interacting protein 3(ENOG4111JAW)
• Kegg: Link to kegg annotations (AT5G37720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419488.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;