Protein coding transcript 48172

• Transcript: Ll_transcript_424475
• CDS coordinates: 1420-2031 (+)
• Peptide sequence: MKKATMISIAVTTTFYMLCGCMGYAAFGDEAPGNLLTGFGFYDPYWLIDIANVAIVVHLVGAYQVFAQPIFAFVEKSAGQRWPNIVDKELNIPLPCLPSYKLNLFRLVWRTMFVILTTVASMLLPFFNGIVGVIGALGFWPLTVYFPVEMYISQKKIPKWSNRWISLQIFSVGCLTVSVVAAVGSVAGVLVDLKKYKPFQSNY*
• ORF Type: complete

Annotations of Ll_transcript_424475

• Blastp: Amino acid permease 2 from Arabidopsis with 70.87% of identity
• Blastx: Amino acid permease 2 from Arabidopsis with 69.4% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G09220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464100.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;