Protein coding transcript 48175

• Transcript: Ll_transcript_424480
• CDS coordinates: 221-832 (+)
• Peptide sequence: MKKATMISIAVTTTFYMLCGCMGYAAFGDEAPGNLLTGFGFYDPYWLIDIANVAIVVHLVGAYQVFAQPIFAFVEKGATQRWPNITNKELNIPIPCFQPYKLNLFRLVWRTVFVIITTVISMLLPFFNGIVGVIGALGFWPLTVYFPVEMYISQKKIPKWSNRWISLQIFSVGCLTISVVAAVGSVAGVLDDLKKFKPFQSNY*
• ORF Type: complete

Annotations of Ll_transcript_424480

• Blastp: Amino acid permease 2 from Arabidopsis with 71.84% of identity
• Blastx: Amino acid permease 3 from Arabidopsis with 72.6% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G09220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462937.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;