Protein coding transcript 482

• Transcript: Ll_transcript_320852
• CDS coordinates: 148-534 (+)
• Peptide sequence: MGPKVACTFIMLTFLFFNCVAIENIPCPPKSTAPPPSISKNAAKCPNDTLKFGVCGSWLGLVTEVIGTKPSEKCCTLVKGLADLEAALCLCTAIKSNVLGIVNLKVHVAVSLIVNACGKKVPDGFLCA*
• ORF Type: complete

Annotations of Ll_transcript_320852

• Blastp: Putative lipid-binding protein At4g00165 from Arabidopsis with 63.83% of identity
• Blastx: Putative lipid-binding protein At4g00165 from Arabidopsis with 64.77% of identity
• Eggnog: Lipid-binding protein(ENOG4111D88)
• Kegg: Link to kegg annotations (AT4G00165)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434455.1)
• Pfam: Probable lipid transfer (PF14368.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;