Protein coding transcript 4820

• Transcript: Ll_transcript_373652
• CDS coordinates: 1813-2451 (+)
• Peptide sequence: MDSFFCLQVLIVAGTETSAVTLEWAMSSLLNNPKVLEKARIELDDEIGQDNLIEETDIPKLKYLQNIISETLRLYPAAPILLPHLSSEDCTIGGYDVPRNTMVMVNAWAIHRDPELWTDPTSFKPERFDNGATDTHSLIPFGLGRRACPGSGLAQKTIGLTLGSMIQCFEWKRISDEEIDMTEKSGTIMPKAIPLEAQCRARPIIIKIFSES*
• ORF Type: complete

Annotations of Ll_transcript_373652

• Blastp: Cytochrome P450 81D11 from Arabidopsis with 62.44% of identity
• Blastx: Cytochrome P450 81E8 from Medicago with 59.4% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT3G28740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422307.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;